PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen06g030590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 388aa    MW: 43786.2 Da    PI: 7.8924
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen06g030590.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.43.5e-50321581128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                       + pGfrF+Ptdeel+++yLkkk+eg++  + evi+ev+i k+ePwdLp k+v ++++ew+fFs+r +ky++g++++rat+sgyWkatgk+++v
  Sopen06g030590.1  32 MFPGFRFSPTDEELISYYLKKKLEGSDKCV-EVISEVEIWKHEPWDLPaKSVIQSDNEWFFFSPRGRKYPNGSQSKRATESGYWKATGKERNV 123
                       579************************777.99***************667777899************************************ PP

               NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +s +++ +g+k+tLvf++grapkg++t+W+mhey +
  Sopen06g030590.1 124 KS-SSNIIGTKRTLVFHTGRAPKGQRTQWIMHEYCM 158
                       **.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-5627175IPR003441NAC domain
PROSITE profilePS5100554.18332176IPR003441NAC domain
PfamPF023651.4E-2634157IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MENEHVSSSS RNETTPRNNA NTEISIATAS SMFPGFRFSP TDEELISYYL KKKLEGSDKC  60
VEVISEVEIW KHEPWDLPAK SVIQSDNEWF FFSPRGRKYP NGSQSKRATE SGYWKATGKE  120
RNVKSSSNII GTKRTLVFHT GRAPKGQRTQ WIMHEYCMIG NTNYQDSMVV CRLRKNSEFH  180
LNDTPRNQRN QLDAIESATA LSGAGQLGSL ELVNVGECCS KEGSSSFHSH SVEQIDSGSE  240
SDKPTKEFSH HDSSGHFKDF DVEDDWFADI MKDDIIKLDD SSLNPRPVSM IPDRPESSGI  300
SNHEAQAAMS SVVPFQGTAN RRLRLVREIV MKCGVKESKP YKAIKKNKVG VGTTSSGRWL  360
RNMFSVEWMR QYVITIFVAT LIFLVMPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-452317511167NAC domain-containing protein 19
3swm_B1e-452317511167NAC domain-containing protein 19
3swm_C1e-452317511167NAC domain-containing protein 19
3swm_D1e-452317511167NAC domain-containing protein 19
3swp_A1e-452317511167NAC domain-containing protein 19
3swp_B1e-452317511167NAC domain-containing protein 19
3swp_C1e-452317511167NAC domain-containing protein 19
3swp_D1e-452317511167NAC domain-containing protein 19
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015078680.10.0PREDICTED: NAC domain-containing protein 40-like
SwissprotQ9XIN74e-83NAC40_ARATH; NAC domain-containing protein 40
TrEMBLK4C9D50.0K4C9D5_SOLLC; Uncharacterized protein
STRINGSolyc06g074170.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.12e-77NTM1-like 8